PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G171365_P01
Common Namem5, mads1, ZEAMMB73_086213
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family MIKC_MADS
Protein Properties Length: 232aa    MW: 26404.2 Da    PI: 9.8916
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G171365_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF93.68.8e-30959151
                       S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
             SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                       krien + rqvtfskRrng+lKKA+ELSvLCdaeva+++fs++gklye++s
  GRMZM2G171365_P01  9 KRIENPTSRQVTFSKRRNGLLKKAFELSVLCDAEVALVVFSPRGKLYEFAS 59
                       79***********************************************86 PP

2K-box73.65.6e-2578171699
              K-box   6 gksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 
                        ++++ +++ e+ + +++ L k++e L+  +R+llGe Le++s++eL++Le +Leksl  iR +K+ell eq+++l++ke +l++ n++Lr+k
  GRMZM2G171365_P01  78 SNKTVQQDIERVKADADGLSKRLEALEAYKRKLLGERLEDCSIEELHSLEVKLEKSLHCIRGRKTELLEEQVRKLKQKEMSLRKSNEDLREK 169
                        344677889**********************************************************************************9 PP

              K-box  98 le 99 
                         +
  GRMZM2G171365_P01 170 CK 171
                        76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004328.2E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.441161IPR002100Transcription factor, MADS-box
PRINTSPR004047.8E-31323IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.98E-33384IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
CDDcd002659.04E-42375No hitNo description
PfamPF003192.6E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004047.8E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004047.8E-313859IPR002100Transcription factor, MADS-box
PfamPF014861.9E-2483171IPR002487Transcription factor, K-box
PROSITE profilePS5129713.50186176IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000060Biological Processprotein import into nucleus, translocation
GO:0009409Biological Processresponse to cold
GO:0009739Biological Processresponse to gibberellin
GO:0009911Biological Processpositive regulation of flower development
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008134Molecular Functiontranscription factor binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 232 aa     Download sequence    Send to blast
MVRGKTQMKR IENPTSRQVT FSKRRNGLLK KAFELSVLCD AEVALVVFSP RGKLYEFASG  60
SAQKTIERYR TYTKDNVSNK TVQQDIERVK ADADGLSKRL EALEAYKRKL LGERLEDCSI  120
EELHSLEVKL EKSLHCIRGR KTELLEEQVR KLKQKEMSLR KSNEDLREKC KKQPPVPMAS  180
APPRAPAVDN VEDGHREPKD DGMDVETELY IGLPGRDYRS SKDKAAVAVR SG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3p57_J7e-19372271Myocyte-specific enhancer factor 2A
3p57_I7e-19372271Myocyte-specific enhancer factor 2A
3p57_D7e-19372271Myocyte-specific enhancer factor 2A
3p57_C7e-19372271Myocyte-specific enhancer factor 2A
3p57_B7e-19372271Myocyte-specific enhancer factor 2A
3p57_A7e-19372271Myocyte-specific enhancer factor 2A
3kov_J7e-19372271Myocyte-specific enhancer factor 2A
3kov_I7e-19372271Myocyte-specific enhancer factor 2A
3kov_B7e-19372271Myocyte-specific enhancer factor 2A
3kov_A7e-19372271Myocyte-specific enhancer factor 2A
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.970580.0endosperm| meristem| shoot
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G171365
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00076ChIP-chipTransfer from AT2G45660Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G171365_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4306420.0AJ430642.1 Zea mays mRNA for putative MADS-domain transcription factor (m5 gene).
GenBankBT0552160.0BT055216.1 Zea mays full-length cDNA clone ZM_BFc0137M15 mRNA, complete cds.
GenBankKM1011250.0KM101125.1 Zea mays cultivar 18-599 SOC1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001105152.11e-170MADS1
SwissprotQ9XJ601e-120MAD50_ORYSJ; MADS-box transcription factor 50
TrEMBLQ9FR851e-170Q9FR85_MAIZE; M5 protein
STRINGGRMZM2G171365_P011e-169(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14133379
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.11e-74AGAMOUS-like 20
Publications ? help Back to Top
  1. Heuer S, et al.
    The maize MADS box gene ZmMADS3 affects node number and spikelet development and is co-expressed with ZmMADS1 during flower development, in egg cells, and early embryogenesis.
    Plant Physiol., 2001. 127(1): p. 33-45
    [PMID:11553732]